DLX4 Rabbit Polyclonal Antibody

CAT#: TA335207

Rabbit Polyclonal Anti-DLX4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Transient overexpression lysate of distal-less homeobox 4 (DLX4), transcript variant 1
    • 100 ug

CNY 3,080.00


Transient overexpression lysate of distal-less homeobox 4 (DLX4), transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of human DLX4. Synthetic peptide located within the following region: KLSVLPPRSLLAPYTVLCCPPDSEKPRLSPEPSERRPQAPAKKLRKPRTI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 26 kDa
Gene Name distal-less homeobox 4
Background DLX4 is a member of the family of Dlx genes that are involved in early vertebrate morphogenesis, notably of the head.Western blots using several different antibodies against different unique regions of this protein target confirm the same apparent molecular weight in our tests.Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function.
Synonyms BP1; DLX7; DLX8; DLX9; OFC15
Note Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Bovine: 85%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...