FMO3 Rabbit Polyclonal Antibody

CAT#: TA335295

Rabbit Polyclonal Anti-FMO3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of flavin containing monooxygenase 3 (FMO3), transcript variant 2
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human flavin containing monooxygenase 3 (FMO3), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human flavin containing monooxygenase 3 (FMO3), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 59 kDa
Gene Name flavin containing monooxygenase 3
Background FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
Synonyms dJ127D3.1; FMOII; TMAU
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rabbit: 93%; Guinea pig: 90%; Horse: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Drug metabolism - cytochrome P450
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...