ALG11 Rabbit Polyclonal Antibody
CAT#: TA335311
Rabbit Polyclonal Anti-ALG11 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ALG11 antibody: synthetic peptide directed towards the middle region of human ALG11. Synthetic peptide located within the following region: LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | ALG11, alpha-1,2-mannosyltransferase |
Database Link | |
Background | The function remains unknown. |
Synonyms | CDG1P; GT8 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, N-Glycan biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |