FCRL6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FCRL6 antibody is: synthetic peptide directed towards the C-terminal region of Human FCRL6. Synthetic peptide located within the following region: HSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	Fc receptor like 6
Database Link	NP_001004310 Entrez Gene 343413 Human UniProt ID Q6DN72
Background	The function of this protein remains unknown.
Synonyms	FcRH6
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.