FHL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FHL2 Antibody: synthetic peptide directed towards the C terminal of human FHL2. Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	four and a half LIM domains 2
Database Link	NP_963849 Entrez Gene 2274 Human UniProt ID Q14192
Background	FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain.
Synonyms	AAG11; DRAL; FHL-2; SLIM-3; SLIM3
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 87%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.