FAM131A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM131A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM131A. Synthetic peptide located within the following region: QDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	family with sequence similarity 131 member A
Database Link	NP_653236 Entrez Gene 131408 Human UniProt ID Q6UXB0
Background	The function of this protein remains unknown.
Synonyms	C3orf40; FLAT715; PRO1378
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 92%; Mouse: 79%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.