PGK2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PGK2 Antibody: synthetic peptide directed towards the C terminal of human PGK2. Synthetic peptide located within the following region: ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	phosphoglycerate kinase 2
Database Link	NP_620061 Entrez Gene 18663 MouseEntrez Gene 5232 Human UniProt ID P07205
Background	PGK2 is a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. See also PGK1 (MIM 311800), which is ubiquitously expressed in all somatic tissues and maps to chromosome Xq13. [supplied by OMIM]. Sequence Note: removed 3 bases from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1675 BC038843.1 4-1678
Synonyms	dJ417L20.2; HEL-S-272; PGKB; PGKPS
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Zebrafish: 86%; Dog: 85%; Sheep: 85%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Glycolysis / Gluconeogenesis, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.