MIRO1 (RHOT1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RHOT1 Antibody: synthetic peptide directed towards the middle region of human RHOT1. Synthetic peptide located within the following region: ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	ras homolog family member T1
Database Link	NP_060777 Entrez Gene 55288 Human UniProt ID Q8IXI2
Background	Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Synonyms	ARHT1; MIRO-1; MIRO1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.