SETD4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SETD4 Antibody: synthetic peptide directed towards the C terminal of human SETD4. Synthetic peptide located within the following region: VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	SET domain containing 4
Database Link	NP_059134 Entrez Gene 54093 Human UniProt ID Q9NVD3
Background	SETD4 contains 1 SET domain. The exact function of SETD4 is not known.
Synonyms	C21orf18; C21orf27
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Dog: 80%; Mouse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.