SETD4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C21ORF18 Antibody: synthetic peptide directed towards the C terminal of human C21ORF18. Synthetic peptide located within the following region: LTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	SET domain containing 4
Database Link	NP_059134 Entrez Gene 54093 Human UniProt ID Q9NVD3
Background	C21orf18, located on chromosome 21, is predicted to encode for a hypothetical protein.
Synonyms	C21orf18; C21orf27
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.