RNF141 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RNF141 Antibody: synthetic peptide directed towards the middle region of human RNF141. Synthetic peptide located within the following region: RIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	ring finger protein 141
Database Link	NP_057506 Entrez Gene 50862 Human UniProt ID Q8WVD5
Background	RNF141 contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis.
Synonyms	ZFP26; ZNF230
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.