PHF16 (JADE3) Rabbit Polyclonal Antibody
CAT#: TA335612
Rabbit Polyclonal Anti-PHF16 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PHF16 Antibody: synthetic peptide directed towards the middle region of human PHF16. Synthetic peptide located within the following region: KSYCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 94 kDa |
Gene Name | jade family PHD finger 3 |
Database Link | |
Background | This gene is part of a gene cluster on chromosome Xp11.23. PHF16 contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known.This gene is part of a gene cluster on chromosome Xp11.23. The encoded protein contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein. |
Synonyms | JADE-3; PHF16 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Dog: 85%; Horse: 85%; Mouse: 85%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |