TCP1 delta (CCT4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	IHC, WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCT4 Antibody: synthetic peptide directed towards the C terminal of human CCT4. Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	chaperonin containing TCP1 subunit 4
Database Link	NP_006421 Entrez Gene 29374 Rat UniProt ID P50991
Background	CCT4 is a subunit of a cytosolic hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. This protein is a member of the chaperonin family, which includes Escherichia coli GroEL, the mitochondrial heat-shock protein Hsp60, the plastid Rubisco-subunit-binding protein and the archaebacterial protein TF55.
Synonyms	CCT-DELTA; Cctd; SRB
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Yeast: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%; Goat: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.