TRIM26 Rabbit Polyclonal Antibody

CAT#: TA335777

Rabbit Polyclonal Anti-TRIM26 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of tripartite motif-containing 26 (TRIM26)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human tripartite motif-containing 26 (TRIM26), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human tripartite motif-containing 26 (TRIM26), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-TRIM26 Antibody: synthetic peptide directed towards the middle region of human TRIM26. Synthetic peptide located within the following region: KKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 62 kDa
Gene Name tripartite motif containing 26
Background TRIM26 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The gene localizes to the major histocompatibility complex (MHC) class I region on chromosome 6.
Synonyms AFP; RNF95; ZNF173
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Mouse: 92%; Pig: 85%; Horse: 85%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...