FOXN2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HTLF Antibody: synthetic peptide directed towards the N terminal of human HTLF. Synthetic peptide located within the following region: KRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	forkhead box N2
Database Link	NP_002149 Entrez Gene 3344 Human UniProt ID P32314
Background	Human T-cell leukemia virus enhancer factor (HTLF) may be a forkhead domain binding protein. It may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.Human T-cell leukemia virus enhancer factor (HTLF) may be a forkhead domain binding protein. It may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.
Synonyms	HTLF
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.