ATG9A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ATG9A Antibody: synthetic peptide directed towards the middle region of human ATG9A. Synthetic peptide located within the following region: VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	94 kDa
Gene Name	autophagy related 9A
Database Link	NP_001070666 Entrez Gene 79065 Human UniProt ID Q7Z3C6
Background	ATG9A belongs to the ATG9 family. It plays a role in autophagy.
Synonyms	APG9L1; mATG9; MGD3208
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 100%; Pig: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.