SI Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SI Antibody: synthetic peptide directed towards the middle region of human SI. Synthetic peptide located within the following region: LPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	209 kDa
Gene Name	sucrase-isomaltase
Database Link	NP_001032 Entrez Gene 6476 Human UniProt ID P14410
Background	SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.
Synonyms	MGC131621; MGC131622
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 90%; Rat: 90%; Guinea pig: 90%; Rabbit: 86%; Zebrafish: 82%; Horse: 79%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Metabolic pathways, Starch and sucrose metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.