VMA21 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-VMA21 Antibody: synthetic peptide directed towards the N terminal of human LOC203547. Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	11 kDa
Gene Name	VMA21 vacuolar H+-ATPase homolog (S. cerevisiae)
Database Link	NP_001017980 Entrez Gene 203547 Human UniProt ID Q3ZAQ7
Background	The function remains unknown.
Synonyms	MEAX; XMEA
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Bovine: 92%; Dog: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.