C1orf103 (LRIF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C1orf103 Antibody: synthetic peptide directed towards the N terminal of human C1orf103. Synthetic peptide located within the following region: KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	ligand dependent nuclear receptor interacting factor 1
Database Link	NP_001006946 Entrez Gene 55791 Human UniProt ID Q5T3J3
Background	The specific function of this protein remains unknown.
Synonyms	C1orf103; RIF1
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rat: 90%; Dog: 86%; Pig: 86%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families	Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.