DNA Ligase I (LIG1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	102 kDa
Gene Name	DNA ligase 1
Database Link	NP_000225 Entrez Gene 3978 Human UniProt ID P18858
Background	LIG1is DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.
Synonyms	MGC117397; MGC130025
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Dog: 92%; Horse: 92%; Pig: 92%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Base excision repair, DNA replication, Mismatch repair, Nucleotide excision repair

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.