Gelsolin (GSN) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC, IF
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	83 kDa
Gene Name	gelsolin
Database Link	NP_000168 Entrez Gene 2934 Human UniProt ID P06396
Background	GSN binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. It is a calcium-regulated protein, which functions in both assembly and disassembly of actin filaments. Defects in the gene encoding GSN are a cause of familial amyloidosis Finnish type (FAF).The protein encoded by this gene binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
Synonyms	ADF; AGEL
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.