CEP27 (HAUS2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HAUS2 antibody is: synthetic peptide directed towards the C-terminal region of Human HAUS2. Synthetic peptide located within the following region: LAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	HAUS augmin like complex subunit 2
Database Link	NP_060567 Entrez Gene 55142 Human UniProt ID Q9NVX0
Background	HAUS2 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly.
Synonyms	C15orf25; CEP27; HsT17025
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rabbit: 86%; Guinea pig: 82%; Dog: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.