Cytokeratin 2 (KRT76) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KRT76 antibody is: synthetic peptide directed towards the C-terminal region of Human KRT76. Synthetic peptide located within the following region: GSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	keratin 76
Database Link	NP_056932 Entrez Gene 51350 Human UniProt ID Q01546
Background	Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13.
Synonyms	HUMCYT2A; KRT2B; KRT2P
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Rat: 83%; Mouse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.