RAB3IP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, WB
Recommend Dilution	WB, IF
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAB3IP antibody: synthetic peptide directed towards the N terminal of human RAB3IP. Synthetic peptide located within the following region: APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	RAB3A interacting protein
Database Link	NP_783322 Entrez Gene 216363 MouseEntrez Gene 117177 Human UniProt ID Q96QF0
Background	The specific function of this protein remains unknown.
Synonyms	RABIN3; RABIN8
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 85%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.