EGFLAM Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	EGF like, fibronectin type III and laminin G domains
Database Link	NP_001192230 Entrez Gene 133584 Human UniProt ID Q63HQ2
Background	EGFLAM is involved in both the retinal photoreceptor ribbon synapse formation and physiological functions of visual perception. It is necessary for proper bipolar dendritic tip apposition to the photoreceptor ribbon synapse and promotes matrix assembly and cell adhesiveness.
Synonyms	AGRINL; AGRNL; PIKA
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.