SPATA24 Rabbit Polyclonal Antibody

CAT#: TA337644

Rabbit Polyclonal Anti-SPATA24 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of spermatogenesis associated 24 (SPATA24)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein from PREDICTED: human hypothetical protein LOC202051, transcript variant 1 (LOC202051), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human hypothetical protein LOC202051 (LOC202051), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SPATA24 antibody: synthetic peptide directed towards the c terminal of human SPATA24. Synthetic peptide located within the following region: LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 23 kDa
Gene Name spermatogenesis associated 24
Background SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.SPATA24 may play a role in cytoplasm movement and removal during spermiogenesis.
Synonyms CCDC161; T6441
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rat: 86%; Guinea pig: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...