PCOLCE Rabbit Polyclonal Antibody
CAT#: TA337676
Rabbit Polyclonal Anti-PCOLCE Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PCOLCE antibody: synthetic peptide directed towards the middle region of human PCOLCE. Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 48 kDa |
Gene Name | procollagen C-endopeptidase enhancer |
Database Link | |
Background | PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity. |
Synonyms | PCPE; PCPE-1; PCPE1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data | |
Protein Families | Secreted Protein |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Heparanase Promotes Tumor Growth and Liver Metastasis of Colorectal Cancer Cells by Activating the p38/MMP1 Axis
,Liu, X;Zhou, ZH;Li, W;Zhang, SK;Li, J;Zhou, MJ;Song, JW;,
Front Oncol
,PubMed ID 31001480
[PCOLCE]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |