PTGES2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the middle region of Human PTGES2. Synthetic peptide located within the following region: VAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	prostaglandin E synthase 2
Database Link	NP_945176 Entrez Gene 80142 Human UniProt ID Q9H7Z7
Background	The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE). Multiple transcript variants have been found for this gene.
Synonyms	C9orf15; GBF-1; GBF1; mPGES-2; PGES2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Rat: 79%; Horse: 79%; Mouse: 79%
Reference Data
Protein Pathways	Arachidonic acid metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.