ZNF568 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF568 antibody: synthetic peptide directed towards the N terminal of human ZNF568. Synthetic peptide located within the following region: VWEVDEQVKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	zinc finger protein 568
Database Link	NP_940941 Entrez Gene 374900 Human UniProt ID Q3ZCX4
Background	May be involved in transcriptional regulation.
Synonyms	DKFZp667O0524; DKFZp686B0797; FLJ34820; FLJ35804
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.