SEZ6 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SEZ6 antibody is: synthetic peptide directed towards the C-terminal region of Human SEZ6. Synthetic peptide located within the following region: RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 105 kDa |
Gene Name | seizure related 6 homolog |
Database Link | |
Background | SEZ6 may play a role in cell-cell recognition and in neuronal membrane signaling. It seems to be important for the achievement of the necessary balance between dendrite elongation and branching during the elaboration of a complex dendritic arbor. SEZ6 is involved in the development of appropriate excitatory synaptic connectivity. |
Synonyms | BSRPC |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |