SEZ6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SEZ6 antibody is: synthetic peptide directed towards the C-terminal region of Human SEZ6. Synthetic peptide located within the following region: RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	105 kDa
Gene Name	seizure related 6 homolog
Database Link	NP_849191 Entrez Gene 124925 Human UniProt ID Q53EL9
Background	SEZ6 may play a role in cell-cell recognition and in neuronal membrane signaling. It seems to be important for the achievement of the necessary balance between dendrite elongation and branching during the elaboration of a complex dendritic arbor. SEZ6 is involved in the development of appropriate excitatory synaptic connectivity.
Synonyms	BSRPC
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.