APLF Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-APLF antibody is: synthetic peptide directed towards the C-terminal region of Human APLF. Synthetic peptide located within the following region: NVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKEDEEKED
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	aprataxin and PNKP like factor
Database Link	NP_775816 Entrez Gene 200558 Human UniProt ID Q8IW19
Background	C2ORF13 is a component of the cellular response to chromosomal DNA single- and double-strand breaks.
Synonyms	APFL; C2orf13; PALF; Xip1; ZCCHH1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.