CCDC117 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCDC117 antibody: synthetic peptide directed towards the middle region of human CCDC117. Synthetic peptide located within the following region: DTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	coiled-coil domain containing 117
Database Link	NP_775781 Entrez Gene 150275 Human UniProt ID Q8IWD4
Background	The function of this protein remains unknown.
Synonyms	dJ366L4.1
Note	Immunogen Sequence Homology:
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.