CCDC78 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCDC78 antibody: synthetic peptide directed towards the middle region of human CCDC78. Synthetic peptide located within the following region: QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	coiled-coil domain containing 78
Database Link	NP_775747 Entrez Gene 124093 Human UniProt ID A2IDD5
Background	The exact function of CCDC78 remains unknown.
Synonyms	C16orf25; coiled-coil domain containing 78; FLJ34512; JFP10; LA16c-444G9.2
Note	Immunogen Sequence Homology: Human: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.