NIRF (UHRF2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the N terminal of human UHRF2. Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	ubiquitin like with PHD and ring finger domains 2
Database Link	NP_690856 Entrez Gene 115426 Human UniProt ID Q96PU4
Background	UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
Synonyms	NIRF; RNF107; TDRD23; URF2
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.