ORAI3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ORAI3 antibody is: synthetic peptide directed towards the N-terminal region of Human ORAI3. Synthetic peptide located within the following region: GDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	ORAI calcium release-activated calcium modulator 3
Database Link	NP_689501 Entrez Gene 93129 Human UniProt ID Q9BRQ5
Background	ORAI3 is a key regulator or component of store-operated Ca2+ channel and transcription factor NFAT nuclear import.
Synonyms	TMEM142C
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.