TAS1R2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TAS1R2 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R2. Synthetic peptide located within the following region: ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	93 kDa
Gene Name	taste 1 receptor member 2
Database Link	NP_689418 Entrez Gene 80834 Human UniProt ID Q8TE23
Background	TAS1R2 is a putative taste receptor. TAS1R2/TAS1R3 recognizes diverse natural and synthetic sweeteners.
Synonyms	GPR71; T1R2; TR2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Taste transduction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.