Prepl Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Prepl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prepl. Synthetic peptide located within the following region: LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	prolyl endopeptidase-like
Database Link	NP_666096 Entrez Gene 213760 Mouse UniProt ID Q8C167
Background	Prepl is a probable serine peptidase whose precise substrate specificity remains unclear. It does not cleave peptides after a arginine or lysine residue.
Synonyms	FLJ16627; KIAA0436; OTTHUMP00000202420; OTTHUMP00000202421; OTTHUMP00000202424; OTTHUMP00000202425; OTTHUMP00000202426; Prolylendopeptidase-like
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.