RNF36 (TRIM69) Rabbit Polyclonal Antibody

CAT#: TA337934

Rabbit Polyclonal Anti-TRIM69 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human tripartite motif-containing 69 (TRIM69), transcript variant b, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of tripartite motif-containing 69 (TRIM69), transcript variant a
    • 100 ug

CNY 3,080.00


Recombinant protein of human tripartite motif-containing 69 (TRIM69), transcript variant b, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of tripartite motif-containing 69 (TRIM69), transcript variant b
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TRIM69 antibody: synthetic peptide directed towards the N terminal of human TRIM69. Synthetic peptide located within the following region: NKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 39 kDa
Gene Name tripartite motif containing 69
Background TRIM69 is a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis.This gene encodes a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Synonyms HSD-34; HSD34; RNF36; Trif
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 90%; Horse: 86%; Bovine: 86%; Dog: 79%; Mouse: 79%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...