AKNA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AKNA antibody is: synthetic peptide directed towards the C-terminal region of Human AKNA. Synthetic peptide located within the following region: SSTPSPKQRSKQAGSSPRPPPGLWYLATAPPAPAPPAFAYISSVPIMPYP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	AT-hook transcription factor
Database Link	NP_110394 Entrez Gene 80709 Human UniProt ID Q7Z591
Background	AKNA is a transcription factor that specifically activates the expression of the CD40 receptor and its ligand CD40L/CD154, two cell surface molecules on lymphocytes that are critical for antigen-dependent-B-cell development. It binds to A/T-rich promoters.
Synonyms	RP11-9M16.2; RP11-82I1.4
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 91%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.