GRLF1 (ARHGAP35) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GRLF1 antibody: synthetic peptide directed towards the N terminal of human GRLF1. Synthetic peptide located within the following region: RPSADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	171 kDa
Gene Name	Rho GTPase activating protein 35
Database Link	NP_077318 Entrez Gene 2909 Human UniProt ID Q9NRY4
Background	The function of this protein remains unknown.
Synonyms	glucocorticoid receptor DNA binding factor 1; GRF-1; KIAA1722; MGC10745; P190-A; P190A; p190RhoGAP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.