CHRDL2 Rabbit Polyclonal Antibody

CAT#: TA338064

Rabbit Polyclonal Anti-CHRDL2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of chordin-like 2 (CHRDL2)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human chordin-like 2 (CHRDL2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human chordin-like 2 (CHRDL2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CHRDL2 antibody is: synthetic peptide directed towards the N-terminal region of Human CHRDL2. Synthetic peptide located within the following region: CTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 3 kDa
Gene Name chordin-like 2
Background CHRDL2 is implicated in tumor angiogenesis. CHRDL2 may inhibits BMPs activity by blocking their interaction with their receptors. CHRDL2 has a negative regulator effect on the cartilage formation/regeneration from immature mesenchymal cells, by preventing or reducing the rate of matrix accumulation. CHRDL2 may play a role during myoblast and osteoblast differentiation, and maturation.
Synonyms BNF1; CHL2
Note Immunogen Sequence Homology: Human: 100%; Yeast: 90%; Mouse: 83%; Rat: 75%
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...