Cog1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cog1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cog1. Synthetic peptide located within the following region: ENQIKKEGAFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRME
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	109 kDa
Gene Name	component of oligomeric golgi complex 1
Database Link	NP_038609 Entrez Gene 16834 Mouse UniProt ID Q9Z160
Background	Cog1 is required for normal Golgi function.
Synonyms	CDG2G; DKFZp762L1710; KIAA1381; LDLB
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Dog: 83%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.