C1orf2 (FAM189B) Rabbit Polyclonal Antibody
CAT#: TA338129
Rabbit Polyclonal Anti-FAM189B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C1orf2 antibody: synthetic peptide directed towards the N terminal of human C1orf2. Synthetic peptide located within the following region: PLLRPCPESGQELKVAPNSTCDEARGALKNLLFSVCGLTICAAIICTLSA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 71 kDa |
Gene Name | family with sequence similarity 189 member B |
Database Link | |
Background | The exact function of C1orf2 remains unknown. |
Synonyms | C1orf2; COTE1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Rabbit: 93%; Rat: 87%; Mouse: 87%; Bovine: 87%; Guinea pig: 80% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |