C1orf2 (FAM189B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1orf2 antibody: synthetic peptide directed towards the N terminal of human C1orf2. Synthetic peptide located within the following region: PLLRPCPESGQELKVAPNSTCDEARGALKNLLFSVCGLTICAAIICTLSA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	family with sequence similarity 189 member B
Database Link	NP_006580 Entrez Gene 10712 Human UniProt ID P81408
Background	The exact function of C1orf2 remains unknown.
Synonyms	C1orf2; COTE1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Rabbit: 93%; Rat: 87%; Mouse: 87%; Bovine: 87%; Guinea pig: 80%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.