ILF1 (FOXK2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the middle region of human FOXK2. Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	forkhead box K2
Database Link	NP_004505 Entrez Gene 3607 Human UniProt ID Q01167
Background	FOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Synonyms	ILF; ILF-1; ILF1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 91%; Mouse: 91%; Dog: 86%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.