DGKE Rabbit Polyclonal Antibody

CAT#: TA338224

Rabbit Polyclonal Anti-DGKE Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of diacylglycerol kinase, epsilon 64kDa (DGKE)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human diacylglycerol kinase, epsilon 64kDa (DGKE), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human diacylglycerol kinase, epsilon 64kDa (DGKE), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 64 kDa
Gene Name diacylglycerol kinase epsilon
Background Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. [provided by RefSeq, Jul 2008]
Synonyms AHUS7; DAGK5; DAGK6; DGK; NPHS7
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 77%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...