UQCRC2 Rabbit Polyclonal Antibody
CAT#: TA338233
Rabbit Polyclonal Anti-UQCRC2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | ubiquinol-cytochrome c reductase core protein II |
Database Link | |
Background | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex. |
Synonyms | MC3DN5; QCR2; UQCR2 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 93%; Rat: 86%; Goat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Phosphorylation of the Ribosomal Protein RPL12/uL11 Affects Translation during Mitosis.
,null,
Molecular cell
,PubMed ID 30220558
[UQCRC2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |