CD49b (ITGA2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, WB
Recommend Dilution	IF, WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	126 kDa
Gene Name	integrin subunit alpha 2
Database Link	NP_002194 Entrez Gene 3673 Human UniProt ID P17301
Background	This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling.
Synonyms	BR; CD49B; GPIa; HPA-5; VLA-2; VLAA2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 92%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.