GPR35 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GPR35 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR35. Synthetic peptide located within the following region: YITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	G protein-coupled receptor 35
Database Link	NP_001182310 Entrez Gene 2859 Human UniProt ID Q9HC97
Background	GPR35 acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
Synonyms	KPG_007
Note	Immunogen Sequence Homology: Human: 100%; Horse: 85%; Dog: 77%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.