Kininogen 1 (KNG1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KNG1 antibody: synthetic peptide directed towards the middle region of human KNG1. Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	kininogen 1
Database Link	NP_001095886 Entrez Gene 3827 Human UniProt ID P01042
Background	This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Synonyms	BDK; BK; KNG
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 85%; Mouse: 77%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Complement and coagulation cascades

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.