Daam2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Daam2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Daam2. Synthetic peptide located within the following region: RFAELVDELDLTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	dishevelled associated activator of morphogenesis 2
Database Link	NP_001008232 Entrez Gene 76441 Mouse UniProt ID Q80U19
Background	The function of this protein remains unknown.
Synonyms	dJ90A20A.1; KIAA0381; MGC90515
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.